PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_52315.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NF-YA
Protein Properties Length: 214aa    MW: 23080.4 Da    PI: 8.4262
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_52315.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.21.1e-32107163158
     CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                   +ep+YVNaKQy++Il+RRq+Rak+e+e+kl +k+rkpylheSRh+hAl+R+Rg gGrF
  MLOC_52315.1 107 EEPVYVNAKQYNAILRRRQSRAKAESERKL-IKGRKPYLHESRHQHALKRARGAGGRF 163
                   69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.3E-35105166IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.934106166IPR001289Nuclear transcription factor Y subunit A
PfamPF020458.3E-27108163IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.0E-23109131IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860111131IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.0E-23140163IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MTSVADAVSG DHRADEQQQK QAAHGNQEEA PATSIGNQAM AATPSTDYVT PYGHQEACHA  60
MQGQIAYPTI DPYYGSLYAA YGGQPMMHPP MVGMHAAAIP LPTDAIEEPV YVNAKQYNAI  120
LRRRQSRAKA ESERKLIKGR KPYLHESRHQ HALKRARGAG GRFLNAKSDD NEEHSDSSSK  180
DKQNGVAPRS SNGQPSSSQS PKGATSADKT GNPE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-22106179174NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3639340.0AK363934.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2020D05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010237027.11e-121PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
RefseqXP_010237028.11e-121PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
RefseqXP_014758866.11e-121PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
SwissprotQ84JP12e-44NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLM0WK991e-158M0WK99_HORVD; Uncharacterized protein
STRINGMLOC_52315.11e-157(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65553853
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.21e-39nuclear factor Y, subunit A7